MRPS36 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87840

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPS36 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MRPS36. Peptide sequence: SHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPS36 Antibody - BSA Free

Western Blot: MRPS36 Antibody [NBP2-87840]

Western Blot: MRPS36 Antibody [NBP2-87840]

Western Blot: MRPS36 Antibody [NBP2-87840] - Host: Rabbit. Target Name: MRPS36. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: MRPS36 Antibody [NBP2-87840]

Western Blot: MRPS36 Antibody [NBP2-87840]

Western Blot: MRPS36 Antibody [NBP2-87840] - Host: Rabbit. Target: MRPS36. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): Human Placenta (PL). Antibody concentration: 1ug/ml

Applications for MRPS36 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS36

MRPS36, also known as Mitochondrial Ribosomal Protein S36, consists of a 103 amino acid isoform that is 11 kDa, and is involved in the synthesis of proteins within the mitochondria. There is no current research being conducted on the relationship between MRPS36 and any diseases or disorders. MRPS36 has been linked to the process of translation, and has been found to interact with UBC and MRPL42.

Alternate Names

DC47,28S ribosomal protein S36, mitochondrial, MGC22896, mitochondrial ribosomal protein S36, MRP-S36S36mt

Gene Symbol

KGD4

Additional MRPS36 Products

Product Documents for MRPS36 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS36 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS36 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS36 Antibody - BSA Free and earn rewards!

Have you used MRPS36 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies