MRPS7 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15524

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human MRPS7 (NP_057055.2). LMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS7 Antibody - Azide and BSA Free

Western Blot: MRPS7 AntibodyAzide and BSA Free [NBP3-15524]

Western Blot: MRPS7 AntibodyAzide and BSA Free [NBP3-15524]

Western Blot: MRPS7 Antibody [NBP3-15524] - Western blot analysis of extracts of various cell lines, using MRPS7 Rabbit pAb (NBP3-15524) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
MRPS7 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MRPS7 Antibody - Azide and BSA Free [NBP3-15524] -

Immunocytochemistry/ Immunofluorescence: MRPS7 Antibody - Azide and BSA Free [NBP3-15524] - Immunofluorescence analysis of C6 cells using MRPS7 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
MRPS7 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MRPS7 Antibody - Azide and BSA Free [NBP3-15524] -

Immunocytochemistry/ Immunofluorescence: MRPS7 Antibody - Azide and BSA Free [NBP3-15524] - Immunofluorescence analysis of L929 cells using MRPS7 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
MRPS7 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MRPS7 Antibody - Azide and BSA Free [NBP3-15524] -

Immunocytochemistry/ Immunofluorescence: MRPS7 Antibody - Azide and BSA Free [NBP3-15524] - Immunofluorescence analysis of U-2 OS cells using MRPS7 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for MRPS7 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MRPS7

MRPS7, or Mitochondrial Ribosomal Protein S7, consists of a 242 amino acid isoform that is 28 kDa, and is involved in the manufacture of proteins within the mitochondria. Researchers are currently conducting experiments on the relationship between MRPS7 and a variety of diseases and disorders, including pseudoxanthoma elasticum, pneumonia, mycobacterium tuberculosis, and genetic disease. MRPS7 interacts with ICT1, ASF1B, MRPS11, UBC, and MRPS14 through the process of translation.

Alternate Names

bMRP27a, bMRP-27a, mitochondrial ribosomal protein S7, MRP-S, MRP-S7,30S ribosomal protein S7 homolog, RPMS7,28S ribosomal protein S7, mitochondrial, RP-S7, S7mt

Gene Symbol

MRPS7

Additional MRPS7 Products

Product Documents for MRPS7 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS7 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MRPS7 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MRPS7 Antibody - Azide and BSA Free and earn rewards!

Have you used MRPS7 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...