MS4A4A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86542

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MS4A4A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MS4A4A Antibody - BSA Free

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human small intestine shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human lymph node shows membranous positivity in lymphoid cells.
Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human placenta shows membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542]

Immunohistochemistry-Paraffin: MS4A4A Antibody [NBP1-86542] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.

Applications for MS4A4A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MS4A4A

MS4A4A encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described. [provided by RefSeq]

Long Name

Membrane-spanning 4-domains, Subfamily A, Member 4A

Alternate Names

4SPAN1, CD20L1, MS4A4, MS4A7

Gene Symbol

MS4A4A

Additional MS4A4A Products

Product Documents for MS4A4A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MS4A4A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MS4A4A Antibody - BSA Free

Customer Reviews for MS4A4A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MS4A4A Antibody - BSA Free and earn rewards!

Have you used MS4A4A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies