MTA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21357

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MTA2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MTA2 Antibody - BSA Free

Western Blot: MTA2 Antibody [NBP3-21357] -

Western Blot: MTA2 Antibody [NBP3-21357] -

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Applications for MTA2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTA2

Official Gene Symbol: MTA2 Gen Bank Accession Number: NP_004730 Gene ID: 9219 (Human) Gene Map Locus: 11q12-q13.1 (human) MTA2, a homologue of human MTA1 and MTA3, is a member of highly conserved MTA gene family. It is a component of NuRD, an ATP-dependent nucleosome remodeling and histone deacetylase complex. MTA2 is a nuclear protein that interacts with HDAC1 and HDAC2 and has a functional role in chromatin remodeling and deacetylase activity. MTA2 specifically interacts with p53 and represses p53-dependant transcriptional activation, thereby regulating p53-mediated cell growth arrest and apoptosis. It also inhibits the transcriptional activity of Estrogen receptor-alpha. Northern Blot analysis detected a ubiquitous expression of MTA2.

Alternate Names

DKFZp686F2281, metastasis associated 1 family, member 2, metastasis -associated gene 1-like 1, metastasis associated gene family, member 2, Metastasis-associated 1-like 1, metastasis-associated protein 2, metastasis-associated protein MTA2, MTA1-L1 protein, MTA1L1MTA1-L1, p53 target protein in deacetylase complex, PID

Gene Symbol

MTA2

Additional MTA2 Products

Product Documents for MTA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MTA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTA2 Antibody - BSA Free and earn rewards!

Have you used MTA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies