MTGR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91617

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MTGR1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of mouse CBFA2T2H. Peptide sequence RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MTGR1 Antibody - BSA Free

Western Blot: MTGR1 Antibody [NBP1-91617]

Western Blot: MTGR1 Antibody [NBP1-91617]

Western Blot: MTGR1 Antibody [NBP1-91617] - NIH-3T3 cells lysate, concentration 0.2-1 ug/ml.

Applications for MTGR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTGR1

In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. Several transcript variants are thought to exist for this gene, but the full-length natures of only three have been described.

Alternate Names

core-binding factor, runt domain, alpha subunit 2; translocated to, 2, EHTDKFZp313F2116, ETO homolog on chromosome 20, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, MTGR1p85, myeloid translocation gene-related protein 1, Myeloid translocation-related protein 1, protein CBFA2T2, ZMYND3

Gene Symbol

CBFA2T2

UniProt

NP_766448 (Mouse)

Additional MTGR1 Products

Product Documents for MTGR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MTGR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTGR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTGR1 Antibody - BSA Free and earn rewards!

Have you used MTGR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies