MTRR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87858

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MTRR. Peptide sequence: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MTRR Antibody - BSA Free

Western Blot: MTRR Antibody [NBP2-87858]

Western Blot: MTRR Antibody [NBP2-87858]

Western Blot: MTRR Antibody [NBP2-87858] - Host: Rabbit. Target Name: MTRR. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: MTRR Antibody [NBP2-87858]

Immunohistochemistry-Paraffin: MTRR Antibody [NBP2-87858]

Immunohistochemistry-Paraffin: MTRR Antibody [NBP2-87858] - Formalin Fixed Paraffin Embedded Tissue: Human Adult liver. Observed Staining: Membrane. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3.
Western Blot: MTRR Antibody [NBP2-87858]

Western Blot: MTRR Antibody [NBP2-87858]

Western Blot: MTRR Antibody [NBP2-87858] - WB Suggested Anti-MTRR antibody Titration: 1 ug/mL. Sample Type: Human liver

Applications for MTRR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTRR

MTRR, also known as Methionine synthase reductase, consists of 3 isoforms, a 725 amino acid isoform 1 that is 80 kDa, a 658 amino acid isoform 2 that is 78 kDa and 58 amino acid isoform 2 that is 6 kDa, cytoplasm located, found in all tissues tested, particularly abundant in skeletal muscle, regenerates a functional methionine synthase via reductive methylation, and it is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Current research is being performed onseveral diseases and disorders including homocystinuria-megaloblastic anemia cbl e type, neural tube defects folate-sensitive, homocystinuria-megaloblastic anemia, neural tube defect, cble, disorders of intracellular cobalamin metabolism, megaloblastic anemia, homocysteine, diffuse large b-cell lymphoma, homocysteine plasma level, cleft lip/palate, age related macular degeneration, deep vein thrombosis, homocystinuria, patent ductus arteriosus, spina bifida, b-cell lymphomas, methylcobalamin deficiency, abdominal aortic aneurysm, hyperhomocysteinemia, and Down syndrome. The protein has been linked to the Antimetabolite Pathway - Folate Cycle, Pharmacodynamics, Methotrexate Pathway (Cancer Cell) Pharmacodynamics, Thiopurine Pathway Pharmacokinetics/Pharmacodynamics, One Carbon Metabolism, Folate Metabolism, Sulfur amino acid metabolism, Biological oxidations, Metabolism of amino acids and derivatives, and Phase II conjugation pathways where it interacts with MMAB, ELAVL1, and UBC proteins.

Alternate Names

[methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing), 5-methyltetrahydrofolate-homocysteine methyltransferase reductase, cblE, EC 1.16.1.8, methionine synthase reductase, methionine synthase reductase, mitochondrial, MGC129643, MSR

Gene Symbol

MTRR

Additional MTRR Products

Product Documents for MTRR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MTRR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTRR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTRR Antibody - BSA Free and earn rewards!

Have you used MTRR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...