Mucolipin 1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87859
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human Mucolipin 1. Peptide sequence: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for Mucolipin 1 Antibody - BSA Free
Western Blot: Mucolipin 1 Antibody [NBP2-87859]
Western Blot: Mucolipin 1 Antibody [NBP2-87859] - Host: Rabbit. Target Name: MCOLN1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/mlWestern Blot: Mucolipin 1 Antibody [NBP2-87859]
Western Blot: Mucolipin 1 Antibody [NBP2-87859] - Host: Rabbit. Target Name: MCOLN1. Sample Tissue: Human Fetal Lung. Antibody Dilution: 1.0ug/mlWestern Blot: Mucolipin 1 Antibody [NBP2-87859]
Western Blot: Mucolipin 1 Antibody [NBP2-87859] - Host: Rabbit. Target Name: MCOLN1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/mlWestern Blot: Mucolipin 1 Antibody [NBP2-87859]
Western Blot: Mucolipin 1 Antibody [NBP2-87859] - Host: Rabbit. Target: MCOLN1. Positive control (+): Human Placenta (PL). Negative control (-): Human liver (LI). Antibody concentration: 1ug/mlWestern Blot: Mucolipin 1 Antibody [NBP2-87859]
Western Blot: Mucolipin 1 Antibody [NBP2-87859] - Host: Rabbit. Target Name: MCOLN1. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/mlApplications for Mucolipin 1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Mucolipin 1
Defects in MCOLN1 are known to cause mucolipidosis type IV (MLIV), also known as sialolipidosis. MLIV is an autosomal recessive lysosomal storage disorder characterized by severe psychomotor retardation and ophthalmologic abnormalities, including corneal opacity, retinal degeneration and strabismus. Storage bodies of lipids and water-soluble substances are seen by electron microscopy in almost every cell type of the patients. Most patients are unable to speak or walk independently and reach a maximal developmental level of 1-2 years. All patients have constitutive achlorhydia associated with a secondary elevation of serum gastrin levels.
Long Name
Mucolipin-1
Alternate Names
MCOLN1, MG-2, ML1, ML4, MSTP080, Mucolipidin, TRPML1
Gene Symbol
MCOLN1
Additional Mucolipin 1 Products
Product Documents for Mucolipin 1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Mucolipin 1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Mucolipin 1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Mucolipin 1 Antibody - BSA Free and earn rewards!
Have you used Mucolipin 1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...