MUTED Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84174

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MUTED Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region MUTED. Peptide sequence: QQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMER The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MUTED Antibody - BSA Free

Western Blot: MUTED Antibody [NBP2-84174]

Western Blot: MUTED Antibody [NBP2-84174]

Western Blot: MUTED Antibody [NBP2-84174] - WB Suggested Anti-MUTED Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellBLOC1S5 is supported by BioGPS gene expression data to be expressed in HeLa

Applications for MUTED Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MUTED

MUTED encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Some transcripts of the downstream gene TXNDC5 overlap this gene, but they do not contain an open reading frame for this gene. [provided by RefSeq]

Alternate Names

DKFZp686E2287, FLJ18427, MUdJ303A1.3, muted homolog (mouse), protein Muted homolog

Gene Symbol

BLOC1S5

Additional MUTED Products

Product Documents for MUTED Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MUTED Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MUTED Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MUTED Antibody - BSA Free and earn rewards!

Have you used MUTED Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies