MX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81018

Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MX2 Antibody - BSA Free

Western Blot: MX2 Antibody [NBP1-81018]

Western Blot: MX2 Antibody [NBP1-81018]

MX2-Antibody-Western-Blot-NBP1-81018-img0008.jpg
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human spleen shows strong positivity in nuclear membrane in cells in red pulp.
Western Blot: MX2 Antibody [NBP1-81018]

Western Blot: MX2 Antibody [NBP1-81018]

Western Blot: MX2 Antibody [NBP1-81018] - Human glioma U87 cell lysate. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human liver shows no postivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human colon shows moderate postivity in nuclear membrane in lymphoid cells in the lamina propria.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human skeletal muscle shows no postivity in myocytes as expected.
Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018]

Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human lymph node shows moderate positivity in nuclear membrane in non-germinal center cells.
MX2 Antibody

Western Blot: MX2 Antibody [NBP1-81018] -

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MX2 Antibody

Western Blot: MX2 Antibody [NBP1-81018] -

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MX2 Antibody

Western Blot: MX2 Antibody [NBP1-81018] -

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MX2 Antibody

Western Blot: MX2 Antibody [NBP1-81018] -

Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MX2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP1-81018 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MX2

MX2 is encoded by this gene has a nuclear and a cytoplasmic form and is a member of both the dynamin family and the family of large GTPases. The nuclear form is localized in a granular pattern in the heterochromatin region beneath the nuclear envelope. A nuclear localization signal (NLS) is present at the amino terminal end of the nuclear form but is lacking in the cytoplasmic form due to use of an alternate translation start codon. This protein is upregulated by interferon-alpha but does not contain the antiviral activity of a similar myxovirus resistance protein 1. [provided by RefSeq]

Alternate Names

human interferon-regulated resistance GTP-binding protein MXB10Interferon-regulated resistance GTP-binding protein MxB, interferon-induced GTP-binding protein Mx2, MXB, myxovirus (influenza virus) resistance 2 (mouse), myxovirus (influenza) resistance 2, homolog of murine, Myxovirus resistance protein 2, p78-related protein, second interferon-induced protein p78

Entrez Gene IDs

4600 (Human)

Gene Symbol

MX2

UniProt

Additional MX2 Products

Product Documents for MX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MX2 Antibody - BSA Free

Customer Reviews for MX2 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • MX2 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human glioma U87 Cell
    Species: Human
    Verified Customer | Posted 01/31/2020
    MX2 Antibody - BSA Free NBP1-81018

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MX2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: What is the concentration of this product?

    A: The concentration of our product NBP1-81018 Lot A83265 is 0.2mg/ml.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...