Myelin expression factor 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87864

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Myelin expression factor 2. Peptide sequence: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Myelin expression factor 2 Antibody - BSA Free

Western Blot: Myelin expression factor 2 Antibody [NBP2-87864]

Western Blot: Myelin expression factor 2 Antibody [NBP2-87864]

Western Blot: Myelin expression factor 2 Antibody [NBP2-87864] - Host: Mouse. Target Name: MYEF2. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-87864]

Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-87864]

Immunohistochemistry-Paraffin: Myelin expression factor 2 Antibody [NBP2-87864] - Rabbit Anti-MYEF2 Antibody. Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Western Blot: Myelin expression factor 2 Antibody [NBP2-87864]

Western Blot: Myelin expression factor 2 Antibody [NBP2-87864]

Western Blot: Myelin expression factor 2 Antibody [NBP2-87864] - Host: Rabbit. Target Name: MYEF2. Sample Tissue: Human 786-0. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: Myelin expression factor 2 Antibody [NBP2-87864]

Immunohistochemistry: Myelin expression factor 2 Antibody [NBP2-87864]

Immunohistochemistry: Myelin expression factor 2 Antibody [NBP2-87864] - Human Lung

Applications for Myelin expression factor 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myelin expression factor 2

Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA

Alternate Names

FLJ11213, HsT18564, KIAA1341MSTP156, MEF-2myEF-2, MGC87325, MST156, MyEF-2, myelin expression factor 2, myelin gene expression factor 2

Gene Symbol

MYEF2

Additional Myelin expression factor 2 Products

Product Documents for Myelin expression factor 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myelin expression factor 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myelin expression factor 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myelin expression factor 2 Antibody - BSA Free and earn rewards!

Have you used Myelin expression factor 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...