Myoferlin Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59396
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to FER1L3(fer-1-like 3, myoferlin (C. elegans)) The peptide sequence was selected from the C terminal of FER1L3. Peptide sequence QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Myoferlin Antibody - BSA Free
Western Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/mlWestern Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.Western Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.Western Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Hela, Antibody Dilution: 1.0 ug/ml MYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa.Western Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.Western Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.Western Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.Western Blot: Myoferlin Antibody [NBP1-59396]
Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.Applications for Myoferlin Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Myoferlin
Alternate Names
fer-1 (C.elegans)-like 3 (myoferlin), FER1L3, fer-1-like 3, myoferlin, fer-1-like 3, myoferlin (C. elegans), Fer-1-like protein 3, FLJ36571, FLJ90777, KIAA1207, myoferlin
Gene Symbol
MYOF
UniProt
Additional Myoferlin Products
Product Documents for Myoferlin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Myoferlin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Myoferlin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Myoferlin Antibody - BSA Free and earn rewards!
Have you used Myoferlin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...