Myoferlin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59396

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to FER1L3(fer-1-like 3, myoferlin (C. elegans)) The peptide sequence was selected from the C terminal of FER1L3. Peptide sequence QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Myoferlin Antibody - BSA Free

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Hela, Antibody Dilution: 1.0 ug/ml MYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396]

Western Blot: Myoferlin Antibody [NBP1-59396] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for Myoferlin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myoferlin

Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length natures have not been determined.

Alternate Names

fer-1 (C.elegans)-like 3 (myoferlin), FER1L3, fer-1-like 3, myoferlin, fer-1-like 3, myoferlin (C. elegans), Fer-1-like protein 3, FLJ36571, FLJ90777, KIAA1207, myoferlin

Gene Symbol

MYOF

UniProt

Additional Myoferlin Products

Product Documents for Myoferlin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myoferlin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myoferlin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myoferlin Antibody - BSA Free and earn rewards!

Have you used Myoferlin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...