MYOM3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85348

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MYOM3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYOM3. Peptide sequence: YRMEVRGTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MYOM3 Antibody - BSA Free

Western Blot: MYOM3 Antibody [NBP2-85348]

Western Blot: MYOM3 Antibody [NBP2-85348]

Western Blot: MYOM3 Antibody [NBP2-85348] - Host: Rabbit. Target Name: MYOM3. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for MYOM3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYOM3

MYOM3, also known as Myomesin-3, contains a 162 kDa, 136 kDa, and 37 kDa isoform, and is involved in linking components within striated muscle. The protein is not currently being used in disease research. MYOM3 is not linked to any pathways, and is not known to interact with any other proteins.

Alternate Names

FLJ35961, MGC71483, Myomesin family member 3, myomesin family, member 3, myomesin-3, RP11-293P20.1

Gene Symbol

MYOM3

Additional MYOM3 Products

Product Documents for MYOM3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MYOM3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MYOM3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MYOM3 Antibody - BSA Free and earn rewards!

Have you used MYOM3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies