Myosin 1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55431

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRY

Reactivity Notes

Mouse 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Myosin 1A Antibody - BSA Free

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431]

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431]

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431]

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431]

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431]

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431]

Immunohistochemistry-Paraffin: Myosin 1A Antibody [NBP2-55431] - Staining in human duodenum and liver tissues using anti-MYO1A antibody. Corresponding MYO1A RNA-seq data are presented for the same tissues.

Applications for Myosin 1A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myosin 1A

MYO1A, also known as Unconventional myosin-Ia, is a 1,043 amino acid protein that is 118 kDa, expressed by enterocytes, the epithelial cells that line the luminal surface of the small intestine, functions as actin-based molecular motor that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force, and potentially it is involved in directing the movement of organelles along actin filaments. Current research is being performed on this proteins involvement in deafness, autosomal dominant 48, spinal cord injury, brachial plexus injuries, sensorineural hearing loss, chronic obstructive pulmonary disease, myotonic dystrophy, pulmonary disease, t cell deficiency, and retinitis. The protein has been linked to the RhoA pathway, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, cellular effects of sildenafil, ILK signaling, epithelial tight junctions, RhoGDI pathway, PAK pathway, and Fc-GammaR-mediated phagocytosis in macrophages pathways where it interacts with BAZ1B, FBL, MAP3K3, SMARCA5, USP20, NEK6, PHLDA3, and over 50 other proteins.

Alternate Names

BBMI, BBM-I, Brush border myosin I, brush border myosin-I, DFNA48, MIHC, MYHL, Myosin I heavy chain, myosin IA, myosin, heavy polypeptide-like (100kD), myosin-Ia

Gene Symbol

MYO1A

Additional Myosin 1A Products

Product Documents for Myosin 1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myosin 1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin 1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myosin 1A Antibody - BSA Free and earn rewards!

Have you used Myosin 1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...