Myosin Heavy Chain 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57681

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Myosin Heavy Chain 1/MYH1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide corresponding to Myosin heavy chain 1 (myosin, heavy chain 1, skeletal muscle, adult) directed towards the N terminal of Myosin heavy chain 1. Peptide sequence: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

223 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Myosin Heavy Chain 1 Antibody - BSA Free

Western Blot: Myosin Heavy Chain 1 Antibody [NBP1-57681]

Western Blot: Myosin Heavy Chain 1 Antibody [NBP1-57681]

Western Blot: Myosin heavy chain 1 Antibody [NBP1-57681] - Sample Tissue: Human OVCAR-3 Antibody Dilution: 1.0 ug/ml
Western Blot: Myosin Heavy Chain 1 Antibody [NBP1-57681]

Western Blot: Myosin Heavy Chain 1 Antibody [NBP1-57681]

Western Blot: Myosin heavy chain 1 Antibody [NBP1-57681] - Human OVCAR-3.
Western Blot: Myosin Heavy Chain 1 Antibody [NBP1-57681]

Western Blot: Myosin Heavy Chain 1 Antibody [NBP1-57681]

Western Blot: Myosin heavy chain 1 Antibody [NBP1-57681] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Applications for Myosin Heavy Chain 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myosin Heavy Chain 1/MYH1

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains.

Long Name

Myosin Heavy Chain 1

Alternate Names

MGC133384, MYH1, MyHC-2x, MyHC-IIx/d, Myosin-1

Gene Symbol

MYH1

UniProt

P12882 (Human)

Additional Myosin Heavy Chain 1/MYH1 Products

Product Documents for Myosin Heavy Chain 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myosin Heavy Chain 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin Heavy Chain 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myosin Heavy Chain 1 Antibody - BSA Free and earn rewards!

Have you used Myosin Heavy Chain 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies