myosin X Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94085

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2). EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for myosin X Antibody - BSA Free

Western Blot: myosin X AntibodyBSA Free [NBP2-94085]

Western Blot: myosin X AntibodyBSA Free [NBP2-94085]

Western Blot: myosin X Antibody [NBP2-94085] - Analysis of extracts of various cell lines, using myosin X.Exposure time: 20s.
Immunocytochemistry/ Immunofluorescence: myosin X Antibody - BSA Free [NBP2-94085]

Immunocytochemistry/ Immunofluorescence: myosin X Antibody - BSA Free [NBP2-94085]

Immunocytochemistry/Immunofluorescence: myosin X Antibody [NBP2-94085] - Immunofluorescence analysis of HeLa cells using myosin X antibody (NBP2-94085) at dilution of 1:350. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: myosin X Antibody - BSA Free [NBP2-94085]

Immunocytochemistry/ Immunofluorescence: myosin X Antibody - BSA Free [NBP2-94085]

Immunocytochemistry/Immunofluorescence: myosin X Antibody [NBP2-94085] - Immunofluorescence analysis of U2OS cells using myosin X antibody (NBP2-94085) at dilution of 1:350. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: myosin X Antibody - BSA Free [NBP2-94085]

Immunocytochemistry/ Immunofluorescence: myosin X Antibody - BSA Free [NBP2-94085]

Immunocytochemistry/Immunofluorescence: myosin X Antibody [NBP2-94085] - Immunofluorescence analysis of A-549 cells using myosin X antibody (NBP2-94085) at dilution of 1:350. Blue: DAPI for nuclear staining.

Applications for myosin X Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: myosin X

Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility.

Alternate Names

FLJ10639, FLJ21066, FLJ22268, KIAA0799FLJ43256, MGC131988, myosin X, myosin-X, Unconventional myosin-10

Gene Symbol

MYO10

Additional myosin X Products

Product Documents for myosin X Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for myosin X Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for myosin X Antibody - BSA Free

There are currently no reviews for this product. Be the first to review myosin X Antibody - BSA Free and earn rewards!

Have you used myosin X Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...