Myotilin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87867

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Myotilin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Myotilin. Peptide sequence: RNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Myotilin Antibody - BSA Free

Western Blot: Myotilin Antibody [NBP2-87867]

Western Blot: Myotilin Antibody [NBP2-87867]

Western Blot: Myotilin Antibody [NBP2-87867] - WB Suggested Anti-MYOT Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

Applications for Myotilin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myotilin

Striated muscle sarcomeres are highly organized structures composed of actin (thin) and myosin (thick) filaments that slide past each other during contraction. The integrity of sarcomeres is controlled by a set of structural proteins, among which are titin (TTN; MIM 188840), a giant molecule that contains several immunoglobulin (Ig)-like domains and associates with thin and thick filaments, and alpha-actinin (ACTN1; MIM 102575), an actin cross-linking protein. Mutations in several sarcomeric and sarcolemmal proteins have been shown to result in muscular dystrophy and cardiomyopathy.[supplied by OMIM]

Alternate Names

57 kDa cytoskeletal protein, LGMD1A, limb-girdle muscular dystrophy 1A (autosomal dominant), Myofibrillar titin-like Ig domains protein, myotilin, Titin immunoglobulin domain protein, titin immunoglobulin domain protein (myotilin), TTIDLGMD1

Gene Symbol

MYOT

Additional Myotilin Products

Product Documents for Myotilin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Myotilin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myotilin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myotilin Antibody - BSA Free and earn rewards!

Have you used Myotilin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies