NAGPA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83254

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NAGPA Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NAGPA. Peptide sequence: GECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NAGPA Antibody - BSA Free

Western Blot: NAGPA Antibody [NBP2-83254]

Western Blot: NAGPA Antibody [NBP2-83254]

Western Blot: NAGPA Antibody [NBP2-83254] - Host: Rabbit. Target Name: NAGPA. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: NAGPA Antibody [NBP2-83254]

Western Blot: NAGPA Antibody [NBP2-83254]

Western Blot: NAGPA Antibody [NBP2-83254] - Host: Rabbit. Target Name: NAGPA. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 3ug/ml

Applications for NAGPA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NAGPA

NAGPA (N-Acetylglucosamine-1-Phosphodiester Alpha-N-Acetylglucosaminidase) plays a role in the process of lysosmal biogenesis as well as removes a covering N-acetylglucosamine from the mannose-6-phosphate recognition marker on lysosomal acid hydrolases. NAGPA is known to have interactions with FURIN, AP2A1, EPS15, DEGS1 and ZHX2. NAGPA has been studied in relation to mucopolysaccharidosis.

Alternate Names

APAA, EC 3.1.4.45, lysosomal alpha-N-acetylglucosaminidase, Mannose 6-phosphate-uncovering enzyme, N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, Phosphodiester alpha-GlcNAcase, UCEalpha-N-acetylglucosaminyl phosphodiesterase

Gene Symbol

NAGPA

Additional NAGPA Products

Product Documents for NAGPA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NAGPA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NAGPA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NAGPA Antibody - BSA Free and earn rewards!

Have you used NAGPA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies