Napsin A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34213

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Napsin A Antibody - BSA Free

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human kidney.
Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes and macrophages.
Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining in human lung and placenta tissues using anti-NAPSA antibody. Corresponding NAPSA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human colon, kidney, lung and lymph node using Anti-NAPSA antibody NBP2-34213 (A) shows similar protein distribution across tissues to independent antibody NBP2-34212 (B).
Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213]

Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human colon.

Applications for Napsin A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Napsin A

Napsin is a pepsin-like aspartic proteinase, in the A1 clan of the AA clade of proteinases. Other AA family proteinases include Pepsin, cathepsin-D, cathepsin-E and rennin. Of these proteinases, napsin is most closely related to cathepsin-D, sharing 46% identity at the amino acid level. There are two closely related Napsins, napsin A and napsin B, with 85% overall identity at the amino acid level. There are three isoforms. Napsin-A is also termed napsin-1, or TA02, a Tumor Adenocarcinoma marker. Napsin A may be involved in processing of pneumocyte surfactant precursors.

Alternate Names

ASP4, KAP, NAPA, NAPSA, Napsin-1, SNAPA, TA01/TA02

Gene Symbol

NAPSA

UniProt

Additional Napsin A Products

Product Documents for Napsin A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Napsin A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Napsin A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Napsin A Antibody - BSA Free and earn rewards!

Have you used Napsin A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...