NAT13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55172

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NAT13 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NAT13(N-acetyltransferase 13) The peptide sequence was selected from the C terminal of NAT13. Peptide sequence AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NAT13 Antibody - BSA Free

Western Blot: NAT13 Antibody [NBP1-55172]

Western Blot: NAT13 Antibody [NBP1-55172]

Western Blot: NAT13 Antibody [NBP1-55172] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Western Blot: NAT13 Antibody [NBP1-55172]

Western Blot: NAT13 Antibody [NBP1-55172]

Western Blot: NAT13 Antibody [NBP1-55172] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.

Applications for NAT13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NAT13

NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.

Alternate Names

EC 2.3.1.-, FLJ13194, hSAN, Mak3 homolog (S. cerevisiae), N(alpha)-acetyltransferase 50, NatE catalytic subunit, N-acetyltransferase 13 (GCN5-related), N-acetyltransferase 5, N-acetyltransferase san homolog, NAT13San, NAT5SAN, NatE catalytic subunit, separation anxiety

Gene Symbol

NAA50

UniProt

Q9GZZ1 (Human)

Additional NAT13 Products

Product Documents for NAT13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NAT13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NAT13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NAT13 Antibody - BSA Free and earn rewards!

Have you used NAT13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies