Nav1.6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84176

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Nav1.6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Nav1.6. Peptide sequence: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nav1.6 Antibody - BSA Free

Western Blot: Nav1.6 Antibody [NBP2-84176]

Western Blot: Nav1.6 Antibody [NBP2-84176]

Western Blot: Nav1.6 Antibody [NBP2-84176] - WB Suggested Anti-SCN8A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle
Western Blot: Nav1.6 Antibody [NBP2-84176]

Western Blot: Nav1.6 Antibody [NBP2-84176]

Western Blot: Nav1.6 Antibody [NBP2-84176] - Host: Rabbit. Target Name: SCN8A. Sample Type: NCI-H226. Antibody Dilution: 1.0ug/mlSCN8A is supported by BioGPS gene expression data to be expressed in NCIH226

Applications for Nav1.6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nav1.6

Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells (Plummer et al., 1998 [PubMed 9828131]).[supplied by OMIM]

Long Name

Sodium channel protein type 8 subunit alpha

Alternate Names

SCN8A

Gene Symbol

SCN8A

Additional Nav1.6 Products

Product Documents for Nav1.6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nav1.6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nav1.6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nav1.6 Antibody - BSA Free and earn rewards!

Have you used Nav1.6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies