NCK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87886

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NCK2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NCK2. Peptide sequence: LGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NCK2 Antibody - BSA Free

Western Blot: NCK2 Antibody [NBP2-87886]

Western Blot: NCK2 Antibody [NBP2-87886]

Western Blot: NCK2 Antibody [NBP2-87886] - Host: Rabbit. Target Name: NCK2. Sample Tissue: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for NCK2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCK2

NCK2 encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Alternate Names

GRB4, NCK adaptor protein 2cytoplasmic protein NCK2, Nck-2, NCKbeta, noncatalytic region of tyrosine kinase, beta, SH2/SH3 adaptor protein NCK-beta

Gene Symbol

NCK2

Additional NCK2 Products

Product Documents for NCK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NCK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NCK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCK2 Antibody - BSA Free and earn rewards!

Have you used NCK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies