NCKIPSD Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56886

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NCKIPSD Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NCKIPSD Antibody - BSA Free

Western Blot: NCKIPSD Antibody [NBP2-56886]

Western Blot: NCKIPSD Antibody [NBP2-56886]

Western Blot: NCKIPSD Antibody [NBP2-56886] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: NCKIPSD Antibody [NBP2-56886]

Immunocytochemistry/ Immunofluorescence: NCKIPSD Antibody [NBP2-56886]

Immunocytochemistry/Immunofluorescence: NCKIPSD Antibody [NBP2-56886] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol.

Applications for NCKIPSD Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCKIPSD

NCKIPSD is encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing occurs in this locus and two transcript variants encoding distinct isoforms have been identified.

Alternate Names

54 kDa vimentin-interacting protein, 90 kDa SH3 protein interacting with Nck, AF3p21, AF3P21DIP-1, dia interacting protein, Dia-interacting protein 1, diaphanous protein interacting protein, Diaphanous protein-interacting protein, DIP, DIP1, MGC23891, NCK interacting protein with SH3 domain, ORF1, SPIN90VIP54, WASLBP, WASP-interacting SH3-domain protein, WISHSH3 adapter protein SPIN90, Wisk90 kDa

Gene Symbol

NCKIPSD

Additional NCKIPSD Products

Product Documents for NCKIPSD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NCKIPSD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NCKIPSD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCKIPSD Antibody - BSA Free and earn rewards!

Have you used NCKIPSD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies