NDRG4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87888

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NDRG4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NDRG4. Peptide sequence: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NDRG4 Antibody - BSA Free

Western Blot: NDRG4 Antibody [NBP2-87888]

Western Blot: NDRG4 Antibody [NBP2-87888]

Western Blot: NDRG4 Antibody [NBP2-87888] - Host: Rabbit. Target Name: NDRG4. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for NDRG4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDRG4

NDRG4 is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Alternate Names

BDM1, Brain development-related molecule 1, DKFZp686I1615, FLJ30586, KIAA1180FLJ42011, NDRG family member 4, protein NDRG4, SMAP-8MGC19632, smooth muscle-associated protein 8, Vascular smooth muscle cell-associated protein 8

Gene Symbol

NDRG4

Additional NDRG4 Products

Product Documents for NDRG4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDRG4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDRG4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDRG4 Antibody - BSA Free and earn rewards!

Have you used NDRG4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies