NDST3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62469

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDST3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NDST3(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3) The peptide sequence was selected from the N terminal of NDST3. Peptide sequence PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

101 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NDST3 Antibody - BSA Free

Western Blot: NDST3 Antibody [NBP1-62469]

Western Blot: NDST3 Antibody [NBP1-62469]

Western Blot: NDST3 Antibody [NBP1-62469] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for NDST3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDST3

NDST3 is a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. NDST3 is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin.

Alternate Names

bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3, EC 2.8.2.8, GlcNAc N-deacetylase/ N-sulfotransferase 3, Glucosaminyl N-deacetylase/N-sulfotransferase 3, hNDST-3, HSST3MGC130028, MGC130029, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3, NDST-3, N-heparan sulfate sulfotransferase 3, N-HSST 3

Gene Symbol

NDST3

UniProt

O95803 (Human)

Additional NDST3 Products

Product Documents for NDST3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDST3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDST3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDST3 Antibody - BSA Free and earn rewards!

Have you used NDST3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies