NDUFA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93743

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFA2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human NDUFA2 (NP_002479.1). MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFA2 Antibody - BSA Free

Western Blot: NDUFA2 AntibodyBSA Free [NBP2-93743]

Western Blot: NDUFA2 AntibodyBSA Free [NBP2-93743]

Western Blot: NDUFA2 Antibody [NBP2-93743] - Analysis of extracts of various cell lines, using NDUFA2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: NDUFA2 Antibody - BSA Free [NBP2-93743]

Immunocytochemistry/ Immunofluorescence: NDUFA2 Antibody - BSA Free [NBP2-93743]

Immunocytochemistry/Immunofluorescence: NDUFA2 Antibody [NBP2-93743] - Analysis of NIH/3T3 cells using NDUFA2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for NDUFA2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFA2

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 (NDUFA2), also known as NADH-ubiquinone oxidoreductase B8 subunit, is an accessory subunit of the hydrophobic protein fraction of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFA2 may also play a role in regulating complex 1 activity and its assembly via assistance in redox processes. Mutations in the NDUFA2 gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder.

Alternate Names

B8, CD14, CIB8, CI-B8, complex I B8 subunit, Complex I-B8, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2, NADH-ubiquinone oxidoreductase B8 subunit, NADH-ubiquinone oxidoreductase subunit CI-B8

Gene Symbol

NDUFA2

Additional NDUFA2 Products

Product Documents for NDUFA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFA2 Antibody - BSA Free and earn rewards!

Have you used NDUFA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies