Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human NDUFA4 (NP_002480). Peptide sequence YLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for NDUFA4 Antibody - BSA Free
Western Blot: NDUFA4 Antibody [NBP3-09939]
Western Blot: NDUFA4 Antibody [NBP3-09939] - Western blot analysis of NDUFA4 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/mlApplications for NDUFA4 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 1 using NBP3-09939 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NDUFA4
Alternate Names
CI-9k, CI-MLRQ, Complex I 9kDa subunit, Complex I-MLRQ, FLJ27440, MGC104422, MGC126843, MGC126845, MLRQ, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4, NADH-ubiquinone oxidoreductase MLRQ subunit
Gene Symbol
NDUFA4
Additional NDUFA4 Products
Product Documents for NDUFA4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NDUFA4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for NDUFA4 Antibody - BSA Free (1)
1 out of 5
1 Customer Rating
Have you used NDUFA4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Simple WesternSample Tested: human brain lysateSpecies: HumanVerified Customer | Posted 04/06/2023NDUFA4 Antibodies NBP3-09939, ProteinSimple Western Blot on Jess Instrument; 3 and 1 microgram of human brain tissue lysate was tested with the antibodies diluted 10 times. No specific signal was detected at any exposure.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...