NDUFB8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85372

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NDUFB8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of NDUFB8. Peptide sequence: KHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NDUFB8 Antibody - BSA Free

Western Blot: NDUFB8 Antibody [NBP2-85372]

Western Blot: NDUFB8 Antibody [NBP2-85372]

Western Blot: NDUFB8 Antibody [NBP2-85372] - WB Suggested Anti-Ndufb8 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart

Applications for NDUFB8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFB8

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

CI-ASHImitochondrial, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa, NADH:ubiquinone oxidoreductase ASHI subunit, NADH-ubiquinone oxidoreductase ASHI subunit

Gene Symbol

NDUFB8

Additional NDUFB8 Products

Product Documents for NDUFB8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFB8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFB8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFB8 Antibody - BSA Free and earn rewards!

Have you used NDUFB8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies