NDUFC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38037

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDUFC2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFC2 (NP_004540.1).

Sequence:
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFC2 Antibody - BSA Free

NDUFC2 Antibody

Western Blot: NDUFC2 Antibody [NBP3-38037] -

Western Blot: NDUFC2 Antibody [NBP3-38037] - Western blot analysis of lysates from A-549 cells, using NDUFC2 Rabbit pAb.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Applications for NDUFC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFC2

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

B14.5b, CI-B14.5b, complex I subunit B14.5b, Complex I-B14.5b, HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b), Human lung cancer oncogene 1 protein, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 subunit C2, NADHDH2, NADH-ubiquinone oxidoreductase subunit B14.5b

Gene Symbol

NDUFC2

Additional NDUFC2 Products

Product Documents for NDUFC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFC2 Antibody - BSA Free and earn rewards!

Have you used NDUFC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies