NEI3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85374

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NEI3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NEI3. Peptide sequence: VLTDFSNKSSTLERKTKQNQILDEEFQNSPPASVCLNDIQHPSKKTTNDI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NEI3 Antibody - BSA Free

Western Blot: NEI3 Antibody [NBP2-85374]

Western Blot: NEI3 Antibody [NBP2-85374]

Western Blot: NEI3 Antibody [NBP2-85374] - Host: Rabbit. Target Name: NEIL3. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for NEI3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NEI3

Prokaryotes and lower eukaryotes possess redundant activities that remove the plethora of oxidative DNA base damages produced during normal oxidative metabolism and which have been associated with cancer and aging. Thus far, only one oxidized pyrimidine-specific DNA glycosylase has been identified in humans, hNthl. HNEI3 is one of three new putative human DNA glycosylases.

Alternate Names

DNA glycosylase FPG2, DNA glycosylase hFPG2, DNA glycosylase/AP lyase Neil3, EC 3.2.2.-, EC 4.2.99.18, endonuclease 8-like 3, Endonuclease VIII-like 3, FGP2, FLJ10858, FPG2, hFPG2, hNEI3, nei endonuclease VIII-like 3 (E. coli), NEI3, Nei-like protein 3

Gene Symbol

NEIL3

Additional NEI3 Products

Product Documents for NEI3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NEI3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NEI3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NEI3 Antibody - BSA Free and earn rewards!

Have you used NEI3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies