NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

Novus Biologicals | Catalog # H00004758-M01-100ug

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3F9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - Detection against Immunogen (34.76 KDa).
Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in Raw 264.7.
Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in IMR-32.
Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

Western Blot: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - NEU1 monoclonal antibody (M01), clone 3F9. Western Blot analysis of NEU1 expression in PC-12.
ELISA: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

ELISA: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug]

ELISA: NEU-1/Sialidase-1 Antibody (3F9) [H00004758-M01-100ug] - Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody.

Applications for NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NEU-1/Sialidase-1

The EGF receptor family comprises several related receptor tyrosine kinases that are frequently overexpressed in a variety of carcinomas. Members of this receptor family include EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3) and ErbB-4 (HER4), which form either homodimers or heterodimers upon ligand binding. Neu, a glycoprotein, undergoes transactivation upon heterodimerization with other EGF receptor family members. Neu heterodimerization with ErbB-3 recruits heregulin, which induces phosphoinositide (PI) 3-kinase activation. Activation of Neu potentiates tumor cell motility and protease secretion and invasion, and also modulates cell cycle checkpoint function, DNA repair and apoptotic responses. Amplification and/or overexpression of Neu occurs in 20-30% of breast carcinomas. Measurement of increased Neu expression can be a predictor of disease prognosis. Neu may also prove to be a promising target for therapeutic agents.

Long Name

N-acetyl-alpha-Neuraminidase 1

Alternate Names

NEU1, Sialidase-1

Entrez Gene IDs

4758 (Human)

Gene Symbol

NEU1

OMIM

256550 (Human)

Additional NEU-1/Sialidase-1 Products

Product Documents for NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free and earn rewards!

Have you used NEU-1/Sialidase-1 Antibody (3F9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...