NEUROD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87903

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NEUROD4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NEUROD4. Peptide sequence: PHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NEUROD4 Antibody - BSA Free

Western Blot: NEUROD4 Antibody [NBP2-87903]

Western Blot: NEUROD4 Antibody [NBP2-87903]

Western Blot: NEUROD4 Antibody [NBP2-87903] - WB Suggested Anti-NEUROD4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Small Intestine

Applications for NEUROD4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NEUROD4

NEUROD4 (neuronal differentiation 4), is a mediator of neuronal differentiation and is thought to act as a transcriptional activator. Disease and disorder research has been conducted in relation to NEUROD4 and neuronitis and neuroendocrine tumor.

Alternate Names

ATH3BHLHA4, ATH-3Protein atonal homolog 3, Atoh3neurogenic differentiation factor 4, bHLHa4ATOH3, Class A basic helix-loop-helix protein 4, MATH-3, NeuroD4, neurogenic differentiation 4

Gene Symbol

NEUROD4

Additional NEUROD4 Products

Product Documents for NEUROD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NEUROD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NEUROD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NEUROD4 Antibody - BSA Free and earn rewards!

Have you used NEUROD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies