Neuroglycan C/CSPG5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56381

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Neuroglycan C/CSPG5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL

Reactivity Notes

Rat 82%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Neuroglycan C/CSPG5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Neuroglycan C/CSPG5 Antibody [NBP2-56381]

Immunocytochemistry/ Immunofluorescence: Neuroglycan C/CSPG5 Antibody [NBP2-56381]

Immunocytochemistry/Immunofluorescence: Neuroglycan C/CSPG5 Antibody [NBP2-56381] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria.

Applications for Neuroglycan C/CSPG5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neuroglycan C/CSPG5

Many cellular activities depend on the interaction of cells with the surrounding extracellular matrix (ECM). Most cells, in intact tissue and in culture, are attached to an ECM. Epithelial cells are associated with the basement membrane; fibroblastic cells are usually embedded in a pericellular mesh of fibrils, and tissue culture cells usually grow on a substrate which is covered by various ECM components. Studies have indicated that the matrix or its various isolated components provide not only adhesive surfaces for cells to grow on but also have effects on the rate of cell growth, mobility, morphogenesis and differentiation. Within the ECM several glycoproteins and proteoglycans have been identified. It has been proposed that the different constituents interact with each other in a rather complex fashion. The poor antigenicity of proteoglycans especially their glycoaminoglycan (GAG) moieties make it difficult to localize these molecules in tissue and cell culture. Monoclonal Anti-Chondroitin Sulfate can be used to study chondroitin sulfate proteoglycan (CSPG) distribution and its relationships to specific cell-substrate contacts.

Alternate Names

CALEB, CSPG5, NGC

Gene Symbol

CSPG5

Additional Neuroglycan C/CSPG5 Products

Product Documents for Neuroglycan C/CSPG5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Neuroglycan C/CSPG5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glial Lineage Markers
Proteoglycans

Customer Reviews for Neuroglycan C/CSPG5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neuroglycan C/CSPG5 Antibody - BSA Free and earn rewards!

Have you used Neuroglycan C/CSPG5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies