Neurokinin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85377

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Neurokinin B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Neurokinin B. Peptide sequence: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Neurokinin B Antibody - BSA Free

Western Blot: Neurokinin B Antibody [NBP2-85377]

Western Blot: Neurokinin B Antibody [NBP2-85377]

Western Blot: Neurokinin B Antibody [NBP2-85377] - WB Suggested Anti-TAC3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human brain

Applications for Neurokinin B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neurokinin B

The Neurokinins, also known as Tachykinins, belong to an evolutionary conserved family of peptide neurotransmitters that share a c-terminal sequence and have an established role in neurotransmission. The mammalian tachykinins include substance P (NK1), neurokinin A (NKA) and neurokinin B (NKB) which exert their effects by binding to specific receptors. Tachykinin peptides are important in the mediation of many physiological and pathological processes including inflammation, pain, migraine headache and allergy induced asthma.

Three tachykinin receptor types have been characterized, NK-1, NK-2 and NK-3 which have preferential affinities for SP, NKA and NKB respectively. All three receptors share a high degree of sequence homology, have seven transmembrane spanning domains and similar signal transduction mechanisms (e.g. G-protein coupled activation of phospholipase C).

Alternate Names

gamma tachykinin 3, neurokinin beta, neurokinin B-like, neuromedin K, preprotachykinin B, PRO1155, tachykinin 3, tachykinin-3, ZNEUROK1NKNBNKB

Gene Symbol

TAC3

Additional Neurokinin B Products

Product Documents for Neurokinin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Neurokinin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neurokinin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neurokinin B Antibody - BSA Free and earn rewards!

Have you used Neurokinin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies