Neuronatin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57015

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Neuronatin Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NNAT (neuronatin) The peptide sequence was selected from the middle region of NNAT. Peptide sequence MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

It has been reported to show no cross-reactivity with mouse in WB via customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Neuronatin Antibody - BSA Free

Western Blot: Neuronatin Antibody [NBP1-57015]

Western Blot: Neuronatin Antibody [NBP1-57015]

Western Blot: Neuronatin Antibody [NBP1-57015] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for Neuronatin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neuronatin

The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.

Alternate Names

MGC1439, neuronatin, Peg5

Gene Symbol

NNAT

UniProt

Q16517-2 (Human)

Additional Neuronatin Products

Product Documents for Neuronatin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Neuronatin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neuronatin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neuronatin Antibody - BSA Free and earn rewards!

Have you used Neuronatin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies