NFYA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87907

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NFYA Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NFYA. Peptide sequence: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NFYA Antibody - BSA Free

Western Blot: NFYA Antibody [NBP2-87907]

Western Blot: NFYA Antibody [NBP2-87907]

Western Blot: NFYA Antibody [NBP2-87907] - WB Suggested Anti-NFYA Antibody Titration: 5.0-8.0ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysateNFYA is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Immunohistochemistry: NFYA Antibody [NBP2-87907]

Immunohistochemistry: NFYA Antibody [NBP2-87907]

Immunohistochemistry: NFYA Antibody [NBP2-87907] - Human Liver

Applications for NFYA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFYA

The Y box is a CCAAT box which is bound by the heteromeric DNA binding protein, NFY (also known as CBF and CP1). Unlike the transcription factors C/EBP and CTF/NF1 which also bind CCAAT like sequences, NFY exhibits a strict binding requirement for this pentanucleotide sequence. Binding sites for this factor have been described for nearly 30% of all eukaryotic genes. Y/CCAAT sequences were frequently observed in the promoter proximal sequences. NF-Y is composed of 3 separate subunits (A,B and C) each of which is required for DNA binding. Each subunit has remained highly conserved throughout evolution. In fact, homologous yeast subunits can substitute for mammalian NF-Y in DNA-binding assays. The conserved core sequences of NF-YB and NF-YC contain a 70 aa region similar to the histone fold motif of nucleosomes H2A and H2B. The unique structure and evolutionary conservation of this transcription factor suggests that it plays a fundamental role in the readout of eukaryotic genetic information.

Alternate Names

CAAT box DNA-binding protein subunit A, CBF-A, CBF-B, CCAAT-binding transcription factor subunit B, FLJ11236, HAP2, HAP2 CCAAT-binding protein, NF-YACAAT-box DNA binding protein subunit A, Nuclear transcription factor Y subunit A, nuclear transcription factor Y subunit alpha, nuclear transcription factor Y, alpha, Transcription factor NF-Y, A subunit

Gene Symbol

NFYA

Additional NFYA Products

Product Documents for NFYA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFYA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFYA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFYA Antibody - BSA Free and earn rewards!

Have you used NFYA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies