NHE8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10574

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NHE8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat NHE8 (NP_001020452). Peptide sequence LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NHE8 Antibody - BSA Free

Western Blot: NHE8 Antibody [NBP3-10574]

Western Blot: NHE8 Antibody [NBP3-10574]

Western Blot: NHE8 Antibody [NBP3-10574] - Western blot analysis of NHE8 in Rat Small Intestine lysates. Antibody dilution at 1.0ug/ml

Applications for NHE8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NHE8

NHE8, also known as SLC9A8, is an integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHE8 is expressed in the kidney, where it may contribute to apical membrane ion transport physiology. NHE8 is highly expressed in the proximal tubules in the outer stripe of the outer medulla with significant but lower expression in the proximal tubules in the cortex. Sodium-Hydrogen ion Exchangers (NHEs) are a growing family of transmembrane proteins, and NHE8 antibodies are useful tools for research on NaH ion exchange.

Long Name

Sodium/hydrogen exchanger 8

Alternate Names

KIAA0939, NHE-8, SLC9A8

Gene Symbol

SLC9A8

Additional NHE8 Products

Product Documents for NHE8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NHE8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NHE8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NHE8 Antibody - BSA Free and earn rewards!

Have you used NHE8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies