NHERF-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91569

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NHERF-2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human Slc9a3r2. Peptide sequence RLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NHERF-2 Antibody - BSA Free

Western Blot: NHERF-2 Antibody [NBP1-91569]

Western Blot: NHERF-2 Antibody [NBP1-91569]

Western Blot: NHERF-2 Antibody [NBP1-91569] - Titration: 1.0 ug/ml Positive Control: Rat Brain.

Applications for NHERF-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NHERF-2

NHERF-2 is a scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.

Alternate Names

E3KARP, Na(+)/H(+) exchange regulatory cofactor NHE-RF2, NHE3RF2, NHERF2MGC104639, NHERF-2NHE3 kinase A regulatory protein E3KARP, OCTS2, SIP-1SRY-interacting protein 1, sodium/hydrogen exchanger, Sodium-hydrogen exchanger regulatory factor 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2, solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatoryfactor 2, solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2, Solute carrier family 9 isoform A3 regulatory factor 2, TKA-1SIP1, Tyrosine kinase activator protein 1

Gene Symbol

SLC9A3R2

UniProt

NP_446263 (Rat)

Additional NHERF-2 Products

Product Documents for NHERF-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NHERF-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NHERF-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NHERF-2 Antibody - BSA Free and earn rewards!

Have you used NHERF-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies