NIF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10511

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NIF1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NIF1 (NP_071378). Peptide sequence EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

145 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NIF1 Antibody - BSA Free

Western Blot: NIF1 Antibody [NBP3-10511]

Western Blot: NIF1 Antibody [NBP3-10511]

Western Blot: NIF1 Antibody [NBP3-10511] - Western blot analysis using NBP3-10511 on Human Brain as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for NIF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NIF1

NIF1 enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. This protein may function by altering local chromatin structure.

Alternate Names

DKFZp586G1122, Hzf, HZFzinc finger protein 385, RZFHematopoietic zinc finger protein, ZFP385, zinc finger protein 385A, ZNF385Retinal zinc finger protein

Gene Symbol

ZNF335

Additional NIF1 Products

Product Documents for NIF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NIF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NIF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NIF1 Antibody - BSA Free and earn rewards!

Have you used NIF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies