NIPSNAP1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05243

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all NIPSNAP1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human NIPSNAP1 (NP_003625.2). NLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NIPSNAP1 Antibody - Azide and BSA Free

Western Blot: NIPSNAP1 AntibodyAzide and BSA Free [NBP3-05243]

Western Blot: NIPSNAP1 AntibodyAzide and BSA Free [NBP3-05243]

Western Blot: NIPSNAP1 Antibody [NBP3-05243] - Western blot analysis of extracts of various cell lines, using NIPSNAP1 antibody (NBP3-05243) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: NIPSNAP1 AntibodyAzide and BSA Free [NBP3-05243]

Western Blot: NIPSNAP1 AntibodyAzide and BSA Free [NBP3-05243]

Western Blot: NIPSNAP1 Antibody [NBP3-05243] - Western blot analysis of extracts of various cell lines, using NIPSNAP1 antibody (NBP3-05243) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for NIPSNAP1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NIPSNAP1

NIPSNAP1 protein has a strong sequence similarity to the central portion of a hypothetical protein encoded by C. elegans chromosome III between a 4-nitrophenylphosphatase (NIP) domain and non-neuronal SNAP25-like protein. The NIPSNAP1 gene is located between the NF2 and pK1.3 genes on 22q12. [provided by RefSeq]

Alternate Names

nipsnap homolog 1 (C. elegans), NIPSNAP, C. elegans, homolog 1,4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1, NipSnap1, protein NipSnap homolog 1

Gene Symbol

NIPSNAP1

Additional NIPSNAP1 Products

Product Documents for NIPSNAP1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NIPSNAP1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NIPSNAP1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NIPSNAP1 Antibody - Azide and BSA Free and earn rewards!

Have you used NIPSNAP1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies