NLRP3/NALP3 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP1-90207PEP
Key Product Details
Source
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP1-90207PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: NLRP3/NALP3
NLRP3 is expressed in a variety of cell types such as monocytes, dendritic cells, lymphocytes and epithelial cells (3). Abnormal NLRP3 activation may occur as the result of inherited mutations and is associated with diseases such as hereditary periodic fevers (HPFs) and familial cold autoinflammatory syndrome (FCAS). Additionally, abnormal NLRP3 activation is associated with a variety of diseases such as gout, obesity, atherosclerosis, Alzheimers, multiple sclerosis and type 2 diabetes (1, 3). NLRP3 inflammasome is regulated by several post-translational modifications (e.g., ubiquitination, phosphorylation and sumoylation) as well as by various interacting proteins (e.g., JNK1, FBXO3, TXNIP, MARK4 and PKD) (4).
References
1. Abderrazak, A., Syrovets, T., Couchie, D., El Hadri, K., Friguet, B., Simmet, T., & Rouis, M. (2015). NLRP3 inflammasome: From a danger signal sensor to a regulatory node of oxidative stress and inflammatory diseases. Redox Biology. https://doi.org/10.1016/j.redox.2015.01.008
2. Yang, Y., Wang, H., Kouadir, M., Song, H., & Shi, F. (2019). Recent advances in the mechanisms of NLRP3 inflammasome activation and its inhibitors. Cell Death and Disease. https://doi.org/10.1038/s41419-019-1413-8
3. Zahid, A., Li, B., Kombe, A. J. K., Jin, T., & Tao, J. (2019). Pharmacological inhibitors of the nlrp3 inflammasome. Frontiers in Immunology. https://doi.org/10.3389/fimmu.2019.02538
4. Kelley, N., Jeltema, D., Duan, Y., & He, Y. (2019). The NLRP3 inflammasome: An overview of mechanisms of activation and regulation. International Journal of Molecular Sciences. https://doi.org/10.3390/ijms20133328
Long Name
Alternate Names
Gene Symbol
Additional NLRP3/NALP3 Products
Product Documents for NLRP3/NALP3 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NLRP3/NALP3 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for NLRP3/NALP3 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review NLRP3/NALP3 Recombinant Protein Antigen and earn rewards!
Have you used NLRP3/NALP3 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
FAQs for NLRP3/NALP3 Recombinant Protein Antigen
-
Q: Are the NLRP3/NALP3 antibodies validated in Simple Western?
A: Yes, we offer a NLRP3/NALP3 antibody that have been tested in Simple Western: NBP2-03948.
-
Q: Does NLRP3/NALP3 antibodies come in lyophilized form?
A: Yes, we carry 3 NLRP2 antibodies in lyophilized format: AF6789, AF7010, MAB6789, MAB7578.
-
Q: What is the theoretical molecular weight for NLRP3/NALP3 antibodies?
A: The TMW of NLRP3/NALP3 antibodies is approximately 118 kDa.
-
Q: Are the NLRP3/NALP3 antibodies validated in Simple Western?
A: Yes, we offer a NLRP3/NALP3 antibody that have been tested in Simple Western: NBP2-03948.
-
Q: Does NLRP3/NALP3 antibodies come in lyophilized form?
A: Yes, we carry 3 NLRP2 antibodies in lyophilized format: AF6789, AF7010, MAB6789, MAB7578.
-
Q: What is the theoretical molecular weight for NLRP3/NALP3 antibodies?
A: The TMW of NLRP3/NALP3 antibodies is approximately 118 kDa.
-
Q: Are the NLRP3/NALP3 antibodies validated in Simple Western?
A: Yes, we offer a NLRP3/NALP3 antibody that have been tested in Simple Western: NBP2-03948.
-
Q: Does NLRP3/NALP3 antibodies come in lyophilized form?
A: Yes, we carry 3 NLRP2 antibodies in lyophilized format: AF6789, AF7010, MAB6789, MAB7578.
-
Q: What is the theoretical molecular weight for NLRP3/NALP3 antibodies?
A: The TMW of NLRP3/NALP3 antibodies is approximately 118 kDa.