NMDAR2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10351

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NMDAR2A (NP_000824). Peptide sequence DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST

Specificity

Epsilon-1 subunit

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

163 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NMDAR2A Antibody - BSA Free

Western Blot: NMDAR2A Antibody [NBP3-10351]

Western Blot: NMDAR2A Antibody [NBP3-10351]

Western Blot: NMDAR2A Antibody [NBP3-10351] - WB Suggested Anti-NMDAR2A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle

Applications for NMDAR2A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NMDAR2A

The ion channels activated by glutamate are divided into two classes. Those that are sensitive to N-methyl-D-aspartate (NMDA) are designated NMDA receptors (NMDAR) while those activated by kainate and a-amino-3-hydroxy-5-methyl-4-isoxalone propionic acid (AMPA) are known as kainate/AMPA receptors (K/AMPAR). NMDA receptors are among the most studied receptors in neuroscience because they are involved in neuronal cell development and plasticity, a cellular correlate for learning. NMDA receptors are also implicated in several disorders of the central nervous system including epilepsy and ischemic neuronal cell death. NMDA receptors also appear to be a target for ethanol at physiological concentrations and therefore may play a significant role in alcoholism.

Alternate Names

GluN2A, glutamate receptor, ionotropic, N-methyl D-aspartate 2A, hNR2A, NMDA receptor subtype 2A, N-methyl D-aspartate receptor subtype 2A, N-methyl-D-aspartate receptor subunit 2A, subunit epsilon-1

Gene Symbol

GRIN2A

Additional NMDAR2A Products

Product Documents for NMDAR2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NMDAR2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NMDAR2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NMDAR2A Antibody - BSA Free and earn rewards!

Have you used NMDAR2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...