NMDARA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85387

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NMDARA1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of NMDARA1. Peptide sequence: FPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVREN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NMDARA1 Antibody - BSA Free

Western Blot: NMDARA1 Antibody [NBP2-85387]

Western Blot: NMDARA1 Antibody [NBP2-85387]

Western Blot: NMDARA1 Antibody [NBP2-85387] - Host: Rabbit. Target Name: GRINA. Antibody Dilution: 1.0ug/ml. Sample Type: NCI-H226 cell lysate
Western Blot: NMDARA1 Antibody [NBP2-85387]

Western Blot: NMDARA1 Antibody [NBP2-85387]

Western Blot: NMDARA1 Antibody [NBP2-85387] - Host: Rabbit. Target Name: GRINA. Sample Type: Human NCI-H226. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/ml. Peptide Concentration: 2.0 ug/ml. Lysate Quantity: 25 ug/lane

Applications for NMDARA1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NMDARA1

Alternate Names

glutamate [NMDA] receptor-associated protein 1, glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding), glutamate receptor, NMDA subtype, glutamate-binding subunit, HNRGW, LFG1, NMDA receptor glutamate-binding subunit, NMDARA1MGC99687, Putative MAPK-activating protein PM02, TMBIM3, transmembrane BAX inhibitor motif containing 3

Gene Symbol

GRINA

Additional NMDARA1 Products

Product Documents for NMDARA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NMDARA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NMDARA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NMDARA1 Antibody - BSA Free and earn rewards!

Have you used NMDARA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies