NMES1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-98391
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Applications
Validated:
Western Blot, Flow Cytometry
Cited:
Western Blot, Flow Cytometry
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen for this antibody is C15orf48 - N-terminal region. Peptide sequence VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for NMES1 Antibody - BSA Free
Western Blot: NMES1 Antibody [NBP1-98391]
Western Blot: NMES1 Antibody [NBP1-98391] - Host: Rabbit. Target Name: C15orf48. Sample Tissue: Human PANC1 Whole Cell. Antibody at 1 ug/mL.Flow Cytometry: NMES1 Antibody [NBP1-98391]
Flow Cytometry: NMES1 Antibody [NBP1-98391] - Anti-NMES1 antibody at 1:500 dilution. Cells were labeled with a FITC-conjugated secondary antibody. Top: unstained; grey; and NMES1-labeled; blue; cells. Bottom: NMES1 fluorescence with no primary antibody added; dotted line; and labeled; solid line; cells. Flow cytometry image submitted by a verified customer review.Western Blot: NMES1 Antibody [NBP1-98391]
Western Blot: NMES1 Antibody [NBP1-98391] - PANC1 Cell Lysate. Antiboyd at 1.0 ug/mL, Gel Concentration: 10-20%.Immunocytochemistry/ Immunofluorescence: NMES1 Antibody - BSA Free [NBP1-98391] -
C15ORF48 expression activates AMPK-ULK1 signaling.a A549 cells stably expressing C15ORF48 (A549/C15ORF48) or the empty (A549/empty) vector were fixed and stained with anti-C15ORF48 antibody and MitoTracker. Nuclei were counter-stained with TO-PRO-3. Representative images are shown from three independent experiments. b A549/empty and A549/C15ORF48 cells were analyzed for mitochondrial membrane potential by staining with TMRM (30 nM) for 30 min. Median TMRM fluorescence intensities are shown as the mean +/- SD. Statistical significance was calculated using two-tailed unpaired Student’s t test (n = 3, biological replicates). c A549/empty and A549/C15ORF48 cells were analyzed for intracellular ATP levels. ATP amount in a cell is shown as the mean +/- SD. Statistical significance was calculated using two-tailed unpaired Student’s t test (n = 3, biological replicates). d A549/empty and A549/C15ORF48 cells were lysed and subjected to western blotting with indicated antibodies. Band intensity was measured, and quantitative ratios are shown. Data are representative of three independent experiments with three biological replicates. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41467-024-45206-1), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for NMES1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Application Notes
This NMES1 antibody is validated for Flow cytometry from a verified customer review.
Reviewed Applications
Read 1 review rated 5 using NBP1-98391 in the following applications:
Flow Cytometry Panel Builder
Bio-Techne Knows Flow Cytometry
Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.
Advanced Features
- Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
- Spillover Popups - Visualize the spectra of individual fluorochromes
- Antigen Density Selector - Match fluorochrome brightness with antigen density
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NMES1
Alternate Names
C15orf48, chromosome 15 open reading frame 48, FLJ22645, FOAP-11, MGC32925, NMES1, NMES1normal mucosa of esophagus specific 1, normal mucosa of esophagus-specific gene 1 protein, Protein FOAP-11
Gene Symbol
C15ORF48
UniProt
Additional NMES1 Products
Product Documents for NMES1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NMES1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for NMES1 Antibody - BSA Free
Customer Reviews for NMES1 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used NMES1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Flow CytometrySample Tested: Cell cultureSpecies: MouseVerified Customer | Posted 07/17/2020Anti-NMES1 at 1:500 dilution. Cells were labeled with a FITC-conjugated secondary antibody. Top: unstained; grey; and NMES1-labeled; blue; cells. Bottom: NMES1 fluorescence with no primary antibody added; dotted line; and labeled; solid line; cells.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- 7-Amino Actinomycin D (7-AAD) Cell Viability Flow Cytometry Protocol
- Cellular Response to Hypoxia Protocols
- Extracellular Membrane Flow Cytometry Protocol
- Flow Cytometry Protocol for Cell Surface Markers
- Flow Cytometry Protocol for Staining Membrane Associated Proteins
- Flow Cytometry Staining Protocols
- Flow Cytometry Troubleshooting Guide
- Intracellular Flow Cytometry Protocol Using Alcohol (Methanol)
- Intracellular Flow Cytometry Protocol Using Detergents
- Intracellular Nuclear Staining Flow Cytometry Protocol Using Detergents
- Intracellular Staining Flow Cytometry Protocol Using Alcohol Permeabilization
- Intracellular Staining Flow Cytometry Protocol Using Detergents to Permeabilize Cells
- Propidium Iodide Cell Viability Flow Cytometry Protocol
- Protocol for Liperfluo
- Protocol for the Characterization of Human Th22 Cells
- Protocol for the Characterization of Human Th9 Cells
- Protocol: Annexin V and PI Staining by Flow Cytometry
- Protocol: Annexin V and PI Staining for Apoptosis by Flow Cytometry
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Fluorokine Flow Cytometry Kits
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...