Nociceptin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58314

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nociceptin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Nociceptin Antibody - BSA Free

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining in human cerebral cortex and colon tissues using anti-PNOC antibody. Corresponding PNOC RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human cerebral cortex, colon, liver and testis using Anti-PNOC anibody NBP2-58314 (A0 shows similar protein distribution tissues o independent antibody.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human testis.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314]

Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human liver.

Applications for Nociceptin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nociceptin

Nociceptin (Orphanin FQ, OFQ), a heptadecapeptide peptide, has been designated as an endogenous ligand for the ORL1 receptor. The amino acid sequence of nociceptin hashomology with other opioid peptides, especially the prodynorphin fragment dynorphin A, suggesting a close evolutionary relationship between the precursors. A diffuse distribution throughout the brain is seen with binding studies and in situ hybridization suggesting an extensive role for nociceptin in a multitude of CNS functions. Immunocytochemical localizations in rat spinal cord have demonstrated nociceptin abundance in superficial dorsal horn, lateral spinal nucleus and the region dorsal to the central canal. Nociceptin immunoreactivity was not affected by dorsal rhizotomy, indicating that in spinal cord the peptide is produced by central rather than primary afferent neurons. The localization is supported by its function in processing of nociceptive signals.

Alternate Names

nociceptin, nocistatin, OFQ, P, PPNOC, prepronociceptin, propronociceptin

Gene Symbol

PNOC

Additional Nociceptin Products

Product Documents for Nociceptin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nociceptin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nociceptin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nociceptin Antibody - BSA Free and earn rewards!

Have you used Nociceptin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies