Nogo B receptor Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09525

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Nogo B receptor (NP_084526). Peptide sequence RLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nogo B receptor Antibody - BSA Free

Western Blot: Nogo B receptor Antibody [NBP3-09525]

Western Blot: Nogo B receptor Antibody [NBP3-09525]

Western Blot: Nogo B receptor Antibody [NBP3-09525] - Western blot analysis of Nogo B receptor in Mouse Heart lysates. Antibody dilution at 1.0ug/ml

Applications for Nogo B receptor Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nogo B receptor

Nogo B receptor acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. Able toregulate vascular remodeling and angiogenesis. Its similarity with UPP synthetase proteins suggests that it may act asa scaffold for the binding of iso

Alternate Names

C6orf68MGC117249, chromosome 6 open reading frame 68, MGC:7199, MGC7199, NgBR, nogo-B receptor, Nuclear undecaprenyl pyrophosphate synthase 1 homolog, nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)

Gene Symbol

NUS1

Additional Nogo B receptor Products

Product Documents for Nogo B receptor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nogo B receptor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nogo B receptor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nogo B receptor Antibody - BSA Free and earn rewards!

Have you used Nogo B receptor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...