NOMO3 Antibody (5A7) - Azide and BSA Free

Novus Biologicals | Catalog # H00408050-M03-100ug

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5A7

Format

Azide and BSA Free
View all NOMO3 Primary Antibodies »

Product Specifications

Immunogen

NOMO3 (NP_001004067.1, 966 a.a. ~ 1033 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for NOMO3 Antibody (5A7) - Azide and BSA Free

Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug]

Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug]

Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug] - Detection against Immunogen (33.22 KDa)
Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug]

Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug]

Western Blot: NOMO3 Antibody (5A7) [H00408050-M03-100ug] - Analysis of NOMO3 expression in Jurkat.
ELISA: NOMO3 Antibody (5A7) [H00408050-M03-100ug]

ELISA: NOMO3 Antibody (5A7) [H00408050-M03-100ug]

ELISA: NOMO3 Antibody (5A7) [H00408050-M03-100ug] - Detection limit for recombinant GST tagged NOMO3 is 0.03 ng/ml as a capture antibody.

Applications for NOMO3 Antibody (5A7) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NOMO3

The NOMO3 gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a duplicated region on the short arm of chromosome 16. These three genes encode closely related proteins that ma

Alternate Names

NODAL modulator 3, Nomo, pM5 protein 3, pM5 protein, middle copy

Entrez Gene IDs

408050 (Human)

Gene Symbol

NOMO3

OMIM

609159 (Human)

UniProt

NP_001004067.1 (Human)

Additional NOMO3 Products

Product Documents for NOMO3 Antibody (5A7) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOMO3 Antibody (5A7) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOMO3 Antibody (5A7) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NOMO3 Antibody (5A7) - Azide and BSA Free and earn rewards!

Have you used NOMO3 Antibody (5A7) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies