NOP10 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93614

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all NOP10 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human NOP10 (NP_061118.1). MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NOP10 Antibody - Azide and BSA Free

Western Blot: NOP10 AntibodyAzide and BSA Free [NBP2-93614]

Western Blot: NOP10 AntibodyAzide and BSA Free [NBP2-93614]

Western Blot: NOP10 Antibody [NBP2-93614] - Western blot analysis of extracts of various cell lines, using NOP10 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for NOP10 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NOP10

The NOP10 gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

Alternate Names

H/ACA ribonucleoprotein complex subunit 3, homolog of yeast Nop10p, MGC70651, NOLA3Nucleolar protein family A member 3, NOP10 ribonucleoprotein homolog (yeast), NOP10P, Nucleolar protein 10, nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs), snoRNP protein NOP10

Gene Symbol

NOP10

Additional NOP10 Products

Product Documents for NOP10 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOP10 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NOP10 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NOP10 Antibody - Azide and BSA Free and earn rewards!

Have you used NOP10 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies