NOS1AP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98487

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NOS1AP Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is NOS1AP - C-terminal region. Peptide sequence PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NOS1AP Antibody - BSA Free

Western Blot: NOS1AP Antibody [NBP1-98487]

Western Blot: NOS1AP Antibody [NBP1-98487]

Western Blot: NOS1AP Antibody [NBP1-98487] - Hela Cell Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for NOS1AP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOS1AP

This gene encodes a cytosolic protein that binds to the signaling molecule, neuronal nitric oxide synthase (nNOS). This protein has a C-terminal PDZ-binding domain that mediates interactions with nNOS and an N-terminal phosphotyrosine binding (PTB) domain that binds to the small monomeric G protein, Dexras1. Studies of the related mouse and rat proteins have shown that this protein functions as an adapter protein linking nNOS to specific targets, such as Dexras1 and the synapsins. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

6330408P19Rik, CAPONMGC138500, carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, KIAA0464C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON), ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain, nitric oxide synthase 1 (neuronal) adaptor protein, Nitric oxide synthase 1 adaptor protein

Gene Symbol

NOS1AP

UniProt

BAA32309 (Human)

Additional NOS1AP Products

Product Documents for NOS1AP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NOS1AP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOS1AP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOS1AP Antibody - BSA Free and earn rewards!

Have you used NOS1AP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies