NRAGE/MAGED1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98411

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NRAGE Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is MAGED1 - C-terminal region. Peptide sequence ACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKLGLLLV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NRAGE/MAGED1 Antibody - BSA Free

Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411]

Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411]

Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411] - Host: Mouse. Target Name: MAGED1. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml
Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411]

Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411]

Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411] - Jurkat Cell Lysate 1.0 ug/ml, Gel Concentration: 12%

Applications for NRAGE/MAGED1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRAGE

This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.

Long Name

Neurotrophin Receptor-interacting MAGE Homolog

Alternate Names

Dlxin-1, MAGED1

Gene Symbol

MAGED1

UniProt

NP_008917 (Human)

Additional NRAGE Products

Product Documents for NRAGE/MAGED1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRAGE/MAGED1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRAGE/MAGED1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRAGE/MAGED1 Antibody - BSA Free and earn rewards!

Have you used NRAGE/MAGED1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies