NRK1 Antibody (2A10) - Azide and BSA Free

Novus Biologicals | Catalog # H00054981-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2A10

Format

Azide and BSA Free
View all NRK1 Primary Antibodies »

Product Specifications

Immunogen

C9orf95 (NP_060351.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAE

Specificity

Reacts with chromosome 9 open reading frame 95.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for NRK1 Antibody (2A10) - Azide and BSA Free

Immunoprecipitation: NRK1 Antibody (2A10) [H00054981-M01]

Immunoprecipitation: NRK1 Antibody (2A10) [H00054981-M01]

Immunoprecipitation: NRK1 Antibody (2A10) [H00054981-M01] - Analysis of C9orf95 transfected lysate using anti-C9orf95 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with C9orf95 MaxPab rabbit polyclonal antibody.
ELISA: NRK1 Antibody (2A10) [H00054981-M01]

ELISA: NRK1 Antibody (2A10) [H00054981-M01]

ELISA: NRK1 Antibody (2A10) [H00054981-M01] - Detection limit for recombinant GST tagged C9orf95 is 0.1 ng/ml as a capture antibody.

Applications for NRK1 Antibody (2A10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunoprecipitation

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NRK1

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]

Long Name

Nicotinamide riboside kinase 1

Alternate Names

C9orf95, NmR-K 1, NMRK1, NRK 1, RNK 1

Entrez Gene IDs

54981 (Human)

Gene Symbol

NMRK1

UniProt

NP_060351 (Human)

Additional NRK1 Products

Product Documents for NRK1 Antibody (2A10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NRK1 Antibody (2A10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRK1 Antibody (2A10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NRK1 Antibody (2A10) - Azide and BSA Free and earn rewards!

Have you used NRK1 Antibody (2A10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies